PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011091920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GeBP
Protein Properties Length: 375aa    MW: 42206 Da    PI: 5.3913
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011091920.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573120.21e-37158253297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     lfqrlwse+Deiv+LqG+id+  k++ +p++d++af++f+kk+++++v+++ql +KirrL+kK+++++ k k+gk+ +fsk+h+qk++elskkiW
  XP_011091920.1 158 LFQRLWSEDDEIVILQGMIDYVIKKKFDPVADLSAFHDFIKKNLHVDVTRTQLQDKIRRLRKKYENNKCKEKEGKDRTFSKPHEQKAYELSKKIW 252
                     69********************************************************************************************* PP

          DUF573  97 g 97 
                     g
  XP_011091920.1 253 G 253
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.1E-34159253IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MAKNWEPKKP VESETESGEE EDDEATSKDA GSQDSDSEPD LAQKAQPQSS SQPQPQLPSS  60
SDEEESGSES ESESDEPDPN VKPIASKPME NEQKSNDGAR KLRSKPIASD LVTPAKSTAT  120
KRPAEEKETE TKDAKKWKKK AEPDTCEKKS TDDSKKLLFQ RLWSEDDEIV ILQGMIDYVI  180
KKKFDPVADL SAFHDFIKKN LHVDVTRTQL QDKIRRLRKK YENNKCKEKE GKDRTFSKPH  240
EQKAYELSKK IWGNESGKEN GVEKVMGNGS ALRKNPSKRP NTVENEEAKD VKSVEVVNSD  300
PERLLPAKRV NSGGVTVEER ILRIGAEYFE SGKGLEGEKE WKKLRVEEME VNLRQLEVKT  360
AQAKLILDAV KSGGH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091920.10.0PREDICTED: mediator-associated protein 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30421947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.15e-24DNA-binding storekeeper protein-related transcriptional regulator